PDB entry 1q3j

View 1q3j on RCSB PDB site
Description: Solution structure of ALO3: a new knottin-type antifungal peptide from the insect Acrocinus longimanus
Class: antifungal protein
Keywords: knottin, cystine-knot, ANTIFUNGAL PROTEIN
Deposited on 2003-07-30, released 2003-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alo3
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83653 (0-35)
  Domains in SCOPe 2.08: d1q3ja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q3jA (A:)
  cikngngcqpngsqgnccsgychkqpgwvagycrrk