PDB entry 1q3f

View 1q3f on RCSB PDB site
Description: uracil dna glycosylase bound to a cationic 1-aza-2'-deoxyribose- containing dna
Deposited on 2003-07-29, released 2004-03-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-23, with a file datestamp of 2004-03-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1q3fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1q3fA (A:)
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel