PDB entry 1q3f

View 1q3f on RCSB PDB site
Description: Uracil DNA glycosylase bound to a cationic 1-aza-2'-deoxyribose-containing DNA
Class: hydrolase/DNA
Keywords: UDG, DNA repair, HYDROLASE-DNA COMPLEX
Deposited on 2003-07-29, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: UNG OR DGU OR UNG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13051 (3-222)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1q3fa1, d1q3fa2
  • Chain 'B':
    Compound: 5'-d(*tp*gp*tp*(nri)p*ap*tp*cp*tp*t)-3'
  • Chain 'C':
    Compound: 5'-d(*ap*ap*ap*gp*ap*tp*ap*ap*cp*a)-3'
  • Heterogens: PO4, URA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q3fA (A:)
    meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
    lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
    llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
    hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.