PDB entry 1q3a

View 1q3a on RCSB PDB site
Description: crystal structure of the catalytic domain of human matrix metalloproteinase 10
Deposited on 2003-07-29, released 2004-04-06
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.278
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q3aa_
  • Chain 'B':
    Domains in SCOP 1.67: d1q3ab_
  • Chain 'C':
    Domains in SCOP 1.67: d1q3ac_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q3aA (A:)
    fssfpgmpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadi
    misfavkehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahe
    lghslglfhsantealmyplynsftelaqfrlsqddvngiqslyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3aA (A:)
    mpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfav
    kehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslg
    lfhsantealmyplynslaqfrlsqddvngiqslyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q3aB (B:)
    fssfpgmpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadi
    misfavkehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahe
    lghslglfhsantealmyplynsftelaqfrlsqddvngiqslyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3aB (B:)
    gmpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfa
    vkehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghsl
    glfhsantealmyplynsftelaqfrlsqddvngiqslyg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q3aC (C:)
    fssfpgmpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadi
    misfavkehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahe
    lghslglfhsantealmyplynsftelaqfrlsqddvngiqslyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3aC (C:)
    pkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfavk
    ehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslgl
    fhsantealmyplynslaqfrlsqddvngiqslyg