PDB entry 1q39

View 1q39 on RCSB PDB site
Description: Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli: The WT enzyme at 2.8 resolution.
Deposited on 2003-07-29, released 2004-08-03
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q39A (A:)
    pegpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn
    dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp
    flqrvgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgl
    tgnhkakdlnaaqldalahalleiprfsyatrgqvdenkhhgalfrfkvfhrdgepcerc
    gsiiekttlssrpfywcpgcqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q39A (A:)
    peirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsndlt
    lyshnqlygvwrvvdtgeettrvlrvklqtadktillysasdiemlrpeqltthpflqrv
    gpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgltgnhk
    akdlnaaqldalahalleiprfsyatrgqvdenkhhgalfrfkvfhrdgepcercgsiie
    kttlssrpfywcpgcqh