PDB entry 1q34

View 1q34 on RCSB PDB site
Description: Crystal structures of two UBC (E2) enzymes of the ubiquitin-conjugating system in Caenorhabditis elegans
Class: ligase
Keywords: alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, LIGASE
Deposited on 2003-07-28, released 2003-08-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.233
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2-21.5 kDa
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: UBC-1 OR C35B1.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1q34a_
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2-21.5 kDa
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: UBC-1 OR C35B1.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1q34b_
  • Chain 'C':
    Compound: Ubiquitin-conjugating enzyme E2-21.5 kDa
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: UBC-1 OR C35B1.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1q34c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q34A (A:)
    mttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklsleft
    eeypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpns
    panslaaqlyqenrreyekrvqqiveqswlnfgenegdavlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q34A (A:)
    ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte
    eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp
    anslaaqlyqenrreyekrvqqiveqswl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q34B (B:)
    mttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklsleft
    eeypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpns
    panslaaqlyqenrreyekrvqqiveqswlnfgenegdavlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q34B (B:)
    ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte
    eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp
    anslaaqlyqenrreyekrvqqiveqswl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q34C (C:)
    mttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklsleft
    eeypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpns
    panslaaqlyqenrreyekrvqqiveqswlnfgenegdavlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q34C (C:)
    ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte
    eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp
    anslaaqlyqenrreyekrvqqiveqswl