PDB entry 1q34

View 1q34 on RCSB PDB site
Description:
Deposited on 2003-07-28, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.233
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1q34a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1q34b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1q34c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q34A (A:)
    mttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklsleft
    eeypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpns
    panslaaqlyqenrreyekrvqqiveqswlnfgenegdavlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q34A (A:)
    ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte
    eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp
    anslaaqlyqenrreyekrvqqiveqswl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q34B (B:)
    mttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklsleft
    eeypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpns
    panslaaqlyqenrreyekrvqqiveqswlnfgenegdavlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q34B (B:)
    ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte
    eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp
    anslaaqlyqenrreyekrvqqiveqswl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q34C (C:)
    mttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklsleft
    eeypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpns
    panslaaqlyqenrreyekrvqqiveqswlnfgenegdavlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q34C (C:)
    ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte
    eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp
    anslaaqlyqenrreyekrvqqiveqswl