PDB entry 1q32

View 1q32 on RCSB PDB site
Description: Crystal Structure Analysis of the Yeast Tyrosyl-DNA Phosphodiesterase
Class: replication,transcription,hydrolase
Keywords: Tyrosyl-DNA Phosphodiesterase; TDP; DNA repair, REPLICATION, TRANSCRIPTION, HYDROLASE, REPLICATION,TRANSCRIPTION,HYDROLASE
Deposited on 2003-07-28, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-06-10, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.214
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosyl-DNA phosphodiesterase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TDP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q32a1, d1q32a2
  • Chain 'B':
    Compound: tyrosyl-DNA phosphodiesterase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TDP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q32b1, d1q32b2
  • Chain 'C':
    Compound: tyrosyl-DNA phosphodiesterase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TDP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q32c1, d1q32c2
  • Chain 'D':
    Compound: tyrosyl-DNA phosphodiesterase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TDP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q32d1, d1q32d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q32A (A:)
    msretnfngtkrkrsdvaekvaqrwksvrysaemenmapvnsnndsddcvivseskiidl
    tnqeqdlserietndtakgavfklmksdfyeredfmgevedmitlkdifgtetlkrsilf
    sfqyeldfllrqfhqnvenitivgqkgtimpiearamdatlavilkkvklieitmppfas
    hhtkliinfydngeckiflpsnnftsmetnlpqqvcwcspllkigkeglpvpfkrsliey
    lnsyhlkdidelitksveevnfaplselefvystpskfqssgllsfynkleklsagtsas
    dtakhylcqtssigtslsrardenlwthlmiplftgimsppakdtagrkkaeilptnsli
    neysqrkikpyiifpteqefvtsplkwsssgwfhfqylqkksyyemlrnkfkvfykqdpa
    mvtrrrgttpahskfymhcatnsagpcdasqvfkelewclytsanlsqtawgtvsrkprn
    yeagvlyhsrrlantrkvtcrtftrdrrgcagnpthvavpftlpvipydlaedecfclar
    hend
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q32A (A:)
    gavfklmksdfyeredmitlkdifgtetlkrsilfsfqyeldfllrqfhqnvenitivgq
    kgtimpiearamdatlavilkkvklieitmppfashhtkliinfydngeckiflpsnnft
    smetnlpqqvcwcspllkigkeglpvpfkrslieylnsyhlkdidelitksveevnfapl
    selefvystpskfqssgllsfynkleklsdtakhylcqtssigtslsrardenlwthlmi
    plftgimsppilptnslineysqrkikpyiifpteqefvtsplkwsssgwfhfqylqkks
    yyemlrnkfkvfykqdpamvtrrrgttpahskfymhcatnsqvfkelewclytsanlsqt
    awgtvsrkprnyeagvlyhsrrlrkvtcrtftrdpthvavpftlpvipydlaedecfcl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q32B (B:)
    msretnfngtkrkrsdvaekvaqrwksvrysaemenmapvnsnndsddcvivseskiidl
    tnqeqdlserietndtakgavfklmksdfyeredfmgevedmitlkdifgtetlkrsilf
    sfqyeldfllrqfhqnvenitivgqkgtimpiearamdatlavilkkvklieitmppfas
    hhtkliinfydngeckiflpsnnftsmetnlpqqvcwcspllkigkeglpvpfkrsliey
    lnsyhlkdidelitksveevnfaplselefvystpskfqssgllsfynkleklsagtsas
    dtakhylcqtssigtslsrardenlwthlmiplftgimsppakdtagrkkaeilptnsli
    neysqrkikpyiifpteqefvtsplkwsssgwfhfqylqkksyyemlrnkfkvfykqdpa
    mvtrrrgttpahskfymhcatnsagpcdasqvfkelewclytsanlsqtawgtvsrkprn
    yeagvlyhsrrlantrkvtcrtftrdrrgcagnpthvavpftlpvipydlaedecfclar
    hend
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q32B (B:)
    gavfklmksdfyermitlkdifgtetlkrsilfsfqyeldfllrqfhqnvenitivgqkg
    timpiearamdatlavilkkvklieitmppfashhtkliinfydngeckiflpsnnftsm
    etnlpqqvcwcspllkigkeglpvpfkrslieylnsyhlkdidelitksveevnfaplse
    lefvystpskfqssgllsfynkleklsdtakhylcqtssigtslsrardenlwthlmipl
    ftgimsilptnslineysqrkikpyiifpteqefvtsplkwsssgwfhfqylqkksyyem
    lrnkfkvfykqdpamvtrrrgttpahskfymhcatasqvfkelewclytsanlsqtawgt
    vsrkprnyeagvlyhsrrlantrkvtcrtftrdpthvavpftlpvipydlaedecfclar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q32C (C:)
    msretnfngtkrkrsdvaekvaqrwksvrysaemenmapvnsnndsddcvivseskiidl
    tnqeqdlserietndtakgavfklmksdfyeredfmgevedmitlkdifgtetlkrsilf
    sfqyeldfllrqfhqnvenitivgqkgtimpiearamdatlavilkkvklieitmppfas
    hhtkliinfydngeckiflpsnnftsmetnlpqqvcwcspllkigkeglpvpfkrsliey
    lnsyhlkdidelitksveevnfaplselefvystpskfqssgllsfynkleklsagtsas
    dtakhylcqtssigtslsrardenlwthlmiplftgimsppakdtagrkkaeilptnsli
    neysqrkikpyiifpteqefvtsplkwsssgwfhfqylqkksyyemlrnkfkvfykqdpa
    mvtrrrgttpahskfymhcatnsagpcdasqvfkelewclytsanlsqtawgtvsrkprn
    yeagvlyhsrrlantrkvtcrtftrdrrgcagnpthvavpftlpvipydlaedecfclar
    hend
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q32C (C:)
    gavfklmksdfyeedmitlkdifgtetlkrsilfsfqyeldfllrqfhqnvenitivgqk
    gtimpiearamdatlavilkkvklieitmppfashhtkliinfydngeckiflpsnnfts
    metnlpqqvcwcspllkigkeglpvpfkrslieylnsyhlkdidelitksveevnfapls
    elefvystpskfqssgllsfynklekltakhylcqtssigtslsrardenlwthlmiplf
    tgimspilptnslineysqrkikpyiifpteqefvtsplkwsssgwfhfqylqkksyyem
    lrnkfkvfykqdpamvtrrrgttpahskfymhcatfkelewclytsanlsqtawgtvsrk
    prnyeagvlyhsrrlantrkvtcrtftrdpthvavpftlpvipydlaedecfclarh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q32D (D:)
    msretnfngtkrkrsdvaekvaqrwksvrysaemenmapvnsnndsddcvivseskiidl
    tnqeqdlserietndtakgavfklmksdfyeredfmgevedmitlkdifgtetlkrsilf
    sfqyeldfllrqfhqnvenitivgqkgtimpiearamdatlavilkkvklieitmppfas
    hhtkliinfydngeckiflpsnnftsmetnlpqqvcwcspllkigkeglpvpfkrsliey
    lnsyhlkdidelitksveevnfaplselefvystpskfqssgllsfynkleklsagtsas
    dtakhylcqtssigtslsrardenlwthlmiplftgimsppakdtagrkkaeilptnsli
    neysqrkikpyiifpteqefvtsplkwsssgwfhfqylqkksyyemlrnkfkvfykqdpa
    mvtrrrgttpahskfymhcatnsagpcdasqvfkelewclytsanlsqtawgtvsrkprn
    yeagvlyhsrrlantrkvtcrtftrdrrgcagnpthvavpftlpvipydlaedecfclar
    hend
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q32D (D:)
    gavfklmksdfyemitlkdifgtetlkrsilfsfqyeldfllrqfhqnvenitivgqkgt
    impiearamdatlavilkkvklieitmppfashhtkliinfydngeckiflpsnnftsme
    tnlpqqvcwcspllkigkeglpvpfkrslieylnsyhlkdidelitksveevnfaplsel
    efvystpskfqssgllsfynkleklssdtakhylcqtssigtslsrardenlwthlmipl
    ftgimspilptnslineysqrkikpyiifpteqefvtsplkwsssgwfhfqylqkksyye
    mlrnkfkvfykqdpamvtrrrgttpahskfymhcatqvfkelewclytsanlsqtawgtv
    srkprnyeagvlyhsrrltrkvtcrtftrdpthvavpftlpvipydlaedecfcl