PDB entry 1q31

View 1q31 on RCSB PDB site
Description: Crystal Structure of the Tobacco Etch Virus Protease C151A mutant
Deposited on 2003-07-28, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1q31a_
  • Chain 'B':
    Domains in SCOP 1.71: d1q31b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q31A (A:)
    geslfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqsl
    hgvfkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtks
    mssmvsdtsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyft
    svpknfmelltnqeaqqwvsgwrlnadsvlwgghkvfmskpeepfqpvkeatqlmnelvy
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q31A (A:)
    lfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhgv
    fkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksmss
    mvsdtsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyftsvp
    knfmelltnqeaqqwvsgwrlnadsvlwgghkvfmskpemnelvysq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q31B (B:)
    geslfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqsl
    hgvfkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtks
    mssmvsdtsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyft
    svpknfmelltnqeaqqwvsgwrlnadsvlwgghkvfmskpeepfqpvkeatqlmnelvy
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q31B (B:)
    lfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhgv
    fkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksmss
    mvsdtsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyftsvp
    knfmelltnqeaqqwvsgwrlnadsvlwgghkvfmskpmnelvysq