PDB entry 1q2z

View 1q2z on RCSB PDB site
Description: The 3D solution structure of the C-terminal region of Ku86
Class: protein binding
Keywords: Ku, DNA repair, protein structure, NMR spectroscopy, DNA-PK, Ku86, Ku80, PROTEIN BINDING
Deposited on 2003-07-28, released 2004-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent DNA helicase II, 80 kDa subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: XRCC5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13010 (0-119)
      • see remark 999 (0-1)
    Domains in SCOPe 2.06: d1q2za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q2zA (A:)
    gpvnpaenfrvlvkqkkasfeeasnqlinhieqfldtnetpyfmksidcirafreeaikf
    seeqrfnnflkalqekveikqlnhfweivvqdgitlitkeeasgssvtaeeakkflapkd