PDB entry 1q2y

View 1q2y on RCSB PDB site
Description: Crystal structure of the protein YJCF from Bacillus subtilis: a member of the GCN5-related N-acetyltransferase superfamily fold
Class: structural genomics, unknown function
Keywords: GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, T804, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, structural genomics, unknown function
Deposited on 2003-07-27, released 2003-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: similar to hypothetical proteins
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31628 (0-139)
  Domains in SCOPe 2.08: d1q2ya_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q2yA (A:)
  mkaviakneeqlkdafyvreevfvkeqnvpaeeeidelenesehivvydgekpvgagrwr
  mkdgygklericvlkshrsagvggiimkalekaaadggasgfilnaqtqavpfykkhgyr
  vlsekefldagiphlqmmkd