PDB entry 1q2x

View 1q2x on RCSB PDB site
Description: Crystal Structure of the E243D Mutant of Aspartate Semialdehyde Dehydrogenase from Haemophilus influenzae bound with substrate aspartate semialdehyde
Deposited on 2003-07-26, released 2004-07-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.238
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q2xA (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkdewkgyaetnkilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2xA (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqalksafdieelkkldiivtcq
    ggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvgg
    nctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdp
    assildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkdewkgyaetnki
    lglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndkei
    tlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q2xB (B:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkdewkgyaetnkilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2xB (B:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqalksafdieelkkldiivtcq
    ggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvgg
    nctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdp
    assildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkdewkgyaetnki
    lglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndkei
    tlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva