PDB entry 1q2x

View 1q2x on RCSB PDB site
Description: Crystal Structure of the E243D Mutant of Aspartate Semialdehyde Dehydrogenase from Haemophilus influenzae bound with substrate aspartate semialdehyde
Class: oxidoreductase
Keywords: enzyme, aspartate semialdehyde dehydrogenase, tetrahedral intermediate, OXIDOREDUCTASE
Deposited on 2003-07-26, released 2004-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.238
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Gene: ASD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44801 (0-370)
      • modified residue (135)
      • engineered (242)
    Domains in SCOPe 2.08: d1q2xa1, d1q2xa2
  • Chain 'B':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Gene: ASD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44801 (0-370)
      • modified residue (135)
      • engineered (242)
    Domains in SCOPe 2.08: d1q2xb1, d1q2xb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q2xA (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkdewkgyaetnkilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2xA (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqalksafdieelkkldiivtcq
    ggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvgg
    nctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdp
    assildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkdewkgyaetnki
    lglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndkei
    tlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q2xB (B:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkdewkgyaetnkilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2xB (B:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqalksafdieelkkldiivtcq
    ggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvgg
    nctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdp
    assildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkdewkgyaetnki
    lglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndkei
    tlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva