PDB entry 1q2v

View 1q2v on RCSB PDB site
Description: Crystal structure of the chaperonin from Thermococcus strain KS-1 (nucleotide-free form)
Class: chaperone
Keywords: HEXADECAMER, CLOSED STATE, chaperone
Deposited on 2003-07-26, released 2004-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
      • engineered (124)
    Domains in SCOPe 2.07: d1q2va1, d1q2va2, d1q2va3
  • Chain 'B':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
      • engineered (124)
    Domains in SCOPe 2.07: d1q2vb1, d1q2vb2, d1q2vb3
  • Chain 'C':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
      • engineered (124)
    Domains in SCOPe 2.07: d1q2vc1, d1q2vc2, d1q2vc3
  • Chain 'D':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
      • engineered (124)
    Domains in SCOPe 2.07: d1q2vd1, d1q2vd2, d1q2vd3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q2vA (A:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2vA (A:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q2vB (B:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2vB (B:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q2vC (C:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2vC (C:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q2vD (D:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2vD (D:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka