PDB entry 1q2s

View 1q2s on RCSB PDB site
Description: Chemical trapping and crystal structure of a catalytic tRNA guanine transglycosylase covalent intermediate
Class: Transferase/RNA
Keywords: TIM barrel, Protein-RNA complex, Covalent intermediat, Transferase/RNA COMPLEX
Deposited on 2003-07-25, released 2003-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.18
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: tgt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q2sa_
  • Chain 'B':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: tgt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q2sb_
  • Chain 'C':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: tgt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q2sc_
  • Chain 'D':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: tgt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q2sd_
  • Chain 'E':
    Compound: 5'-r(*ap*gp*cp*ap*cp*gp*gp*cp*up*(pq1)p*up*ap*ap*ap*cp*cp*gp*up*gp*c)-3'
  • Chain 'F':
    Compound: RNA (5'-r(*ap*gp*cp*ap*cp*gp*gp*cp*up*(n)p*up*ap*ap*ap*cp*cp*gp*up*gp*c)-3')
  • Heterogens: ZN, 9DG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q2sA (A:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2sA (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
    srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
    eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
    lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
    lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
    sqfaqdfraryfarns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q2sB (B:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2sB (B:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
    srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
    eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
    lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
    lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
    sqfaqdfraryf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q2sC (C:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2sC (C:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
    srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
    eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
    lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
    lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
    sqfaqdfraryfarns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q2sD (D:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2sD (D:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
    srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
    eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
    lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
    lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
    sqfaqdfraryf
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.