PDB entry 1q2h

View 1q2h on RCSB PDB site
Description: Phenylalanine Zipper Mediates APS Dimerization
Class: signaling protein
Keywords: signal transduction, SIGNALING PROTEIN
Deposited on 2003-07-24, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.25
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adaptor protein with pleckstrin homology and src homology 2 domains
    Species: Homo sapiens [TaxId:9606]
    Gene: APS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q2ha_
  • Chain 'B':
    Compound: adaptor protein with pleckstrin homology and src homology 2 domains
    Species: Homo sapiens [TaxId:9606]
    Gene: APS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q2hb_
  • Chain 'C':
    Compound: adaptor protein with pleckstrin homology and src homology 2 domains
    Species: Homo sapiens [TaxId:9606]
    Gene: APS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14492 (4-End)
      • initiator methionine (3)
    Domains in SCOPe 2.07: d1q2hc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q2hA (A:)
    gshmpdwrqfcelhaqaaavdfahkfcrflrdnpaydtpdagasfsrhfaanfldvfgee
    vrrvlvagp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2hA (A:)
    pdwrqfcelhaqaaavdfahkfcrflrdnpaydtpdagasfsrhfaanfldvfgeevrrv
    lva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q2hB (B:)
    gshmpdwrqfcelhaqaaavdfahkfcrflrdnpaydtpdagasfsrhfaanfldvfgee
    vrrvlvagp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2hB (B:)
    pdwrqfcelhaqaaavdfahkfcrflrdnpaydtpdagasfsrhfaanfldvfgeevrrv
    lv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q2hC (C:)
    gshmpdwrqfcelhaqaaavdfahkfcrflrdnpaydtpdagasfsrhfaanfldvfgee
    vrrvlvagp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2hC (C:)
    mpdwrqfcelhaqaaavdfahkfcrflrdnpaydtpdagasfsrhfaanfldvfgeevrr
    vlv