PDB entry 1q2c

View 1q2c on RCSB PDB site
Description: Crystal Structure of Tetrahymena GCN5 With Bound Coenzyme A and a 19-residue Histone H4 Peptide
Class: transferase/structural protein
Keywords: Tetrahymena; GCN5; Histone H4; X-ray structure, TRANSFERASE-STRUCTURAL PROTEIN COMPLEX
Deposited on 2003-07-24, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.252
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone acetyltransferase gcn5
    Species: Tetrahymena thermophila [TaxId:5911]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27198 (0-161)
      • cloning artifact (41)
      • cloning artifact (161)
    Domains in SCOPe 2.07: d1q2ca1, d1q2ca2
  • Chain 'B':
    Compound: Histone H4 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q2C
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1q2cA (A:)
ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr

  • Chain 'B':
    No sequence available.