PDB entry 1q2c

View 1q2c on RCSB PDB site
Description: Crystal Structure of Tetrahymena GCN5 With Bound Coenzyme A and a 19-residue Histone H4 Peptide
Deposited on 2003-07-24, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.252
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1q2ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1q2cA (A:)
ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr