PDB entry 1q28

View 1q28 on RCSB PDB site
Description: Dihydropteroate syntahse from Bacillus anthracis with bound pterine molecule
Class: transferase
Keywords: anthracis pteroate; dihydropteroate DHPS; pterine, TRANSFERASE
Deposited on 2003-07-23, released 2004-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.223
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis
    Gene: FolP
    Database cross-references and differences (RAF-indexed):
    • GB NP_654021
    Domains in SCOPe 2.06: d1q28a_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis
    Gene: FolP
    Database cross-references and differences (RAF-indexed):
    • GB NP_654021
    Domains in SCOPe 2.06: d1q28b_
  • Heterogens: SO4, PE0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q28A (A:)
    mkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahii
    diggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiin
    diwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrden
    iildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtga
    tvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q28A (A:)
    kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
    iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind
    iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni
    ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat
    vclgiekgcefvrvhdvkemsrmakmmdamigk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q28B (B:)
    mkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahii
    diggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiin
    diwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrden
    iildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtga
    tvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q28B (B:)
    kwdydlrcgeytlnlnektlimgilggsynevdaavrhakemrdegahiidiggvsveee
    ikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiaevaahyd
    vpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfaktpeqnlea
    mrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefvrvhdvk
    emsrmakmmdamigk