PDB entry 1q22

View 1q22 on RCSB PDB site
Description: Crystal structure of human cholesterol sulfotransferase (SULT2B1b) in the presence of DHEA and PAP
Class: transferase
Keywords: sulfotransferase, dhea, PAP, SULT2B1b, TRANSFERASE
Deposited on 2003-07-23, released 2003-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfotransferase family, cytosolic, 2B, member 1 isoform b
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT2B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00204 (5-End)
      • cloning artifact (4)
    Domains in SCOPe 2.08: d1q22a1, d1q22a2
  • Heterogens: NA, A3P, AND, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q22A (A:)
    gspnsdiseisqklpgeyfrykgvpfpvglyslesislaentqdvrdddifiitypksgt
    twmieiiclilkegdpswirsvpiwerapwcetivgafslpdqysprlmsshlpiqiftk
    affsskakviymgrnprdvvvslyhyskiagqlkdpgtpdqflrdflkgevqfgswfdhi
    kgwlrmkgkdnflfityeelqqdlqgsvericgflgrplgkealgsvvahstfsamkant
    msnytllppslldhrrgaflrkgvcgdwknhftvaqseafdrayrkqmrgmptfpwded
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q22A (A:)
    sdiseisqklpgeyfrykgvpfpvglyslesislaentqdvrdddifiitypksgttwmi
    eiiclilkegdpswirsvpiwerapwcetivgafslpdprlmsshlpiqiftkaffsska
    kviymgrnprdvvvslyhyskiagqlkdpgtpdqflrdflkgevqfgswfdhikgwlrmk
    gkdnflfityeelqqdlqgsvericgflgrplgkealgsvvahstfsamkantmsnytll
    ppslldhrrgaflrkgvcgdwknhftvaqseafdrayrkqmrgmptfpwde