PDB entry 1q1z

View 1q1z on RCSB PDB site
Description: Crystal structure of human cholesterol sulfotransferase (SULT2B1b) in the presence of PAP
Class: transferase
Keywords: sulfotransferase, SULT2B1, PAP, TRANSFERASE
Deposited on 2003-07-23, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfotransferase family, cytosolic, 2B, member 1 isoform b
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT2B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q1za_
  • Heterogens: NA, A3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q1zA (A:)
    gspnsdiseisqklpgeyfrykgvpfpvglyslesislaentqdvrdddifiitypksgt
    twmieiiclilkegdpswirsvpiwerapwcetivgafslpdqysprlmsshlpiqiftk
    affsskakviymgrnprdvvvslyhyskiagqlkdpgtpdqflrdflkgevqfgswfdhi
    kgwlrmkgkdnflfityeelqqdlqgsvericgflgrplgkealgsvvahstfsamkant
    msnytllppslldhrrgaflrkgvcgdwknhftvaqseafdrayrkqmrgmptfpwded
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1zA (A:)
    klpgeyfrykgvpfpvglyslesislaentqdvrdddifiitypksgttwmieiiclilk
    egdpswirsvpiwerapwcetivgafslpdsprlmsshlpiqiftkaffsskakviymgr
    nprdvvvslyhyskiagqlkdpgtpdqflrdflkgevqfgswfdhikgwlrmkgkdnflf
    ityeelqqdlqgsvericgflgrplgkealgsvvahstfsamkantmsnytllppslldh
    rrgaflrkgvcgdwknhftvaqseafdrayrkqmrgmptfpwde