PDB entry 1q1v

View 1q1v on RCSB PDB site
Description: Structure of the Oncoprotein DEK: a putative DNA-binding Domain Related to the Winged Helix Motif
Class: DNA binding protein
Keywords: winged-helix motif, DNA binding protein
Deposited on 2003-07-22, released 2004-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DEK protein
    Species: Homo sapiens [TaxId:9606]
    Gene: dek
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35659 (0-66)
      • cloning artifact (67-69)
    Domains in SCOPe 2.08: d1q1va1, d1q1va2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q1vA (A:)
    deplikklkkpptdeelketikkllasanleevtmkqickkvyenyptydlterkdfikt
    tvkelisleh