PDB entry 1q1u

View 1q1u on RCSB PDB site
Description: Crystal structure of human FHF1b (FGF12b)
Class: hormone/growth factor
Keywords: FGF-12; Human; crystal structure, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2003-07-22, released 2003-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.223
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrobast growth factor homologous factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q1ua_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q1uA (A:)
    meskepqlkgivtrlfsqqgyflqmhpdgtidgtkdensdytlfnlipvglrvvaiqgvk
    aslyvamngegylyssdvftpeckfkesvfenyyviysstlyrqqesgrawflglnkegq
    imkgnrvkktkpsshfvpkpieva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1uA (A:)
    pqlkgivtrlfsqqgyflqmhpdgtidgtkdensdytlfnlipvglrvvaiqgvkaslyv
    amngegylyssdvftpeckfkesvfenyyviysstlyrqqesgrawflglnkegqimkgn
    rvkktkpsshfvpkpiev