PDB entry 1q1r

View 1q1r on RCSB PDB site
Description: Crystal Structure of Putidaredoxin Reductase from Pseudomonas putida
Deposited on 2003-07-22, released 2004-02-24
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-24, with a file datestamp of 2004-02-24.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.213
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q1rA (A:)
    mnandnvvivgtglagvevafglrasgwegnirlvgdatviphhlpplskaylagkatae
    slylrtpdayaaqniqllggtqvtainrdrqqvilsdgraldydrlvlatggrprplpva
    sgavgkannfrylrtledaecirrqliadnrlvvigggyiglevaataikanmhvtlldt
    aarvlervtappvsafyehlhreagvdirtgtqvcgfemstdqqkvtavlcedgtrlpad
    lviagiglipncelasaaglqvdngivinehmqtsdplimavgdcarfhsqlydrwvrie
    svpnaleqarkiaailcgkvprdeaapwfwsdqyeiglkmvglsegydriivrgslaqpd
    fsvfylqgdrvlavdtvnrpvefnqskqiitdrlpvepnllgdesvplkeiiaaakaels
    saparhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1rA (A:)
    nandnvvivgtglagvevafglrasgwegnirlvgdatviphhlpplskaylagkataes
    lylrtpdayaaqniqllggtqvtainrdrqqvilsdgraldydrlvlatggrprplpvas
    gavgkannfrylrtledaecirrqliadnrlvvigggyiglevaataikanmhvtlldta
    arvlervtappvsafyehlhreagvdirtgtqvcgfemstdqqkvtavlcedgtrlpadl
    viagiglipncelasaaglqvdngivinehmqtsdplimavgdcarfhsqlydrwvries
    vpnaleqarkiaailcgkvprdeaapwfwsdqyeiglkmvglsegydriivrgslaqpdf
    svfylqgdrvlavdtvnrpvefnqskqiitdrlpvepnllgdesvplkeiiaaakaelss
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q1rB (B:)
    mnandnvvivgtglagvevafglrasgwegnirlvgdatviphhlpplskaylagkatae
    slylrtpdayaaqniqllggtqvtainrdrqqvilsdgraldydrlvlatggrprplpva
    sgavgkannfrylrtledaecirrqliadnrlvvigggyiglevaataikanmhvtlldt
    aarvlervtappvsafyehlhreagvdirtgtqvcgfemstdqqkvtavlcedgtrlpad
    lviagiglipncelasaaglqvdngivinehmqtsdplimavgdcarfhsqlydrwvrie
    svpnaleqarkiaailcgkvprdeaapwfwsdqyeiglkmvglsegydriivrgslaqpd
    fsvfylqgdrvlavdtvnrpvefnqskqiitdrlpvepnllgdesvplkeiiaaakaels
    saparhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1rB (B:)
    nandnvvivgtglagvevafglrasgwegnirlvgdatviphhlpplskaylagkataes
    lylrtpdayaaqniqllggtqvtainrdrqqvilsdgraldydrlvlatggrprplpvas
    gavgkannfrylrtledaecirrqliadnrlvvigggyiglevaataikanmhvtlldta
    arvlervtappvsafyehlhreagvdirtgtqvcgfemstdqqkvtavlcedgtrlpadl
    viagiglipncelasaaglqvdngivinehmqtsdplimavgdcarfhsqlydrwvries
    vpnaleqarkiaailcgkvprdeaapwfwsdqyeiglkmvglsegydriivrgslaqpdf
    svfylqgdrvlavdtvnrpvefnqskqiitdrlpvepnllgdesvplkeiiaaakaelss
    a