PDB entry 1q1q

View 1q1q on RCSB PDB site
Description: crystal structure of human pregnenolone sulfotransferase (sult2b1a) in the presence of pap
Deposited on 2003-07-22, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.249
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q1qa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q1qA (A:)
    maspppfhsqklpgeyfrykgvpfpvglyslesislaentqdvrdddifiitypksgttw
    mieiiclilkegdpswirsvpiwerapwcetivgafslpdqysprlmsshlpiqiftkaf
    fsskakviymgrnprdvvvslyhyskiagqlkdpgtpdqflrdflkgevqfgswfdhikg
    wlrmkgkdnflfityeelqqdlqgsvericgflgrplgkealgsvvahstfsamkantms
    nytllppslldhrrgaflrkgvcgdwknhftvaqseafdrayrkqmrgmptfpwdedpee
    dgspdpepspepepkpslepntslereprpnsspspspgqasetphprps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1qA (A:)
    lpgeyfrykgvpfpvglyslesislaentqdvrdddifiitypksgttwmieiiclilke
    gdpswirsvpiwerapwcetivgasprlmsshlpiqiftkaffsskakviymgrnprdvv
    vslyhyskiagqlkdpgtpdqflrdflkgevqfgswfdhikgwlrmkgkdnflfityeel
    qqdlqgsvericgflgrplgkealgsvvahstfsamkantmsnytllppslldhrrgafl
    rkgvcgdwknhftvaqseafdrayrkqmrgmptfpwde