PDB entry 1q1p

View 1q1p on RCSB PDB site
Description: E-Cadherin activation
Class: cell adhesion
Keywords: cell adhesion
Deposited on 2003-07-22, released 2004-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.262
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epithelial-cadherin
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q1pa1, d1q1pa2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1q1pA (A:)
wvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlk
vtqpldreaiakyilyshavssngeavedpmeivitvtdqndnrpeftqevfegsvaega
vpgtsvmkvsatdadddvntynaaiaytivsqdpelphknmftvnrdtgvisvltsgldr
esyptytlvvqaadlqgeglsttakavitvkd