PDB entry 1q1o

View 1q1o on RCSB PDB site
Description: solution structure of the pb1 domain of cdc24p (long form)
Deposited on 2003-07-22, released 2003-10-14
The last revision prior to the SCOP 1.71 freeze date was dated 2003-10-14, with a file datestamp of 2003-10-14.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1q1oa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q1oA (A:)
  gplgsilfrisynnnsnntssseiftllvekvwnfddlimainskisnthnnnispitki
  kyqdedgdfvvlgsdedwnvakemlaennekflnirly