PDB entry 1q1n

View 1q1n on RCSB PDB site
Description: apo and holo structures of an nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae
Deposited on 2003-07-22, released 2004-08-03
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.24
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q1nA (A:)
    msypekfegiaiqshedwknpkktkydpkpfydhdidikieacgvcgsdihcaaghwgnm
    kmplvvgheivgkvvklgpksnsglkvgqrvgvgaqvfsclecdrckndnepyctkfvtt
    ysqpyedgyvsqggyanyvrvhehfvvpipenipshlaapllcggltvysplvrngcgpg
    kkvgivglggigsmgtliskamgaetyvisrssrkredamkmgadhyiatleegdwgeky
    fdtfdlivvcassltdidfnimpkamkvggrivsisipeqhemlslkpyglkavsisysa
    lgsikelnqllklvsekdikiwvetlpvgeagvheafermekgdvryrftlvgydkefsd