PDB entry 1q1j

View 1q1j on RCSB PDB site
Description: Crystal Structure Analysis of anti-HIV-1 Fab 447-52D in complex with V3 peptide
Class: immune system
Keywords: Fab-peptide complex, HIV-1, gp120, V3 loop, IMMUNE SYSTEM
Deposited on 2003-07-21, released 2004-02-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.25
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 447-52D, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q1J (0-230)
    Domains in SCOPe 2.03: d1q1jh1, d1q1jh2
  • Chain 'I':
    Compound: Fab 447-52D, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q1J (0-230)
    Domains in SCOPe 2.03: d1q1ji1, d1q1ji2
  • Chain 'L':
    Compound: Fab 447-52D, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q1J (0-214)
    Domains in SCOPe 2.03: d1q1jl1, d1q1jl2
  • Chain 'M':
    Compound: Fab 447-52D, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q1J (0-214)
    Domains in SCOPe 2.03: d1q1jm1, d1q1jm2
  • Chain 'P':
    Compound: gp120 V3 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q1J
  • Chain 'Q':
    Compound: gp120 V3 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q1J
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q1jH (H:)
    evqlvesggglvkpggslrltcvasgftfsdvwlnwvrqapgkglewvgriksrtdggtt
    dyaasvkgrftisrddskntlylqmnslktedtavyscttdgfimirgvsedyyyyymdv
    wgkgttvtvssastkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsg
    vhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q1jI (I:)
    evqlvesggglvkpggslrltcvasgftfsdvwlnwvrqapgkglewvgriksrtdggtt
    dyaasvkgrftisrddskntlylqmnslktedtavyscttdgfimirgvsedyyyyymdv
    wgkgttvtvssastkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsg
    vhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q1jL (L:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvlwyqqfpgtapklliygnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyfcatwdsglsadwvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q1jM (M:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvlwyqqfpgtapklliygnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyfcatwdsglsadwvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.