PDB entry 1q1j

View 1q1j on RCSB PDB site
Description: Crystal Structure Analysis of anti-HIV-1 Fab 447-52D in complex with V3 peptide
Deposited on 2003-07-21, released 2004-02-17
The last revision prior to the SCOP 1.71 freeze date was dated 2004-02-17, with a file datestamp of 2004-02-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.25
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q1jH (H:)
    evqlvesggglvkpggslrltcvasgftfsdvwlnwvrqapgkglewvgriksrtdggtt
    dyaasvkgrftisrddskntlylqmnslktedtavyscttdgfimirgvsedyyyyymdv
    wgkgttvtvssastkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsg
    vhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q1jI (I:)
    evqlvesggglvkpggslrltcvasgftfsdvwlnwvrqapgkglewvgriksrtdggtt
    dyaasvkgrftisrddskntlylqmnslktedtavyscttdgfimirgvsedyyyyymdv
    wgkgttvtvssastkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsg
    vhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q1jL (L:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvlwyqqfpgtapklliygnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyfcatwdsglsadwvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q1jM (M:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvlwyqqfpgtapklliygnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyfcatwdsglsadwvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapte