PDB entry 1q1h

View 1q1h on RCSB PDB site
Description: An extended winged helix domain in general transcription factor E/IIE alpha
Class: transcription
Keywords: TFE, TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble, promoter melting, TFIIH
Deposited on 2003-07-21, released 2003-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.315
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription Factor E
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: tfE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q1ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q1hA (A:)
    mvnaedlfinlaksllgddvidvlrilldkgtemtdeeianqlnikvndvrkklnlleeq
    gfvsyrktrdkdsgwfiyywkpnidqineillnrkrlildklktrleyek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1hA (A:)
    mvnaedlfinlaksllgddvidvlrilldkgtemtdeeianqlnikvndvrkklnlleeq
    gfvsyrktrsgwfiyywkpnidqin