PDB entry 1q1f

View 1q1f on RCSB PDB site
Description: Crystal structure of murine neuroglobin
Class: oxygen storage/transport
Keywords: globin fold, heme protein, neuroglobin, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2003-07-19, released 2004-06-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.21
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97
      • engineered (54)
      • engineered (119)
    Domains in SCOPe 2.04: d1q1fa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q1fA (A:)
    merpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspe
    fldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymleks
    lgpdftpatrtawsrlygavvqamsrgwdge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1fA (A:)
    rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
    dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
    pdftpatrtawsrlygavvqamsrgwdg