PDB entry 1q1d

View 1q1d on RCSB PDB site
Description: Crystal Structure of the ATPase region of Saccharomyces Cerevisiae topoisomerase II bound to ICRF-187 (dexrazoxane)
Class: isomerase
Keywords: ghkl ATPase domain, icrf, icrf-187 dexrazoxane
Deposited on 2003-07-18, released 2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2003-09-30, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase II
    Species: Saccharomyces cerevisiae
    Gene: TOP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q1da1, d1q1da2
  • Chain 'B':
    Compound: DNA topoisomerase II
    Species: Saccharomyces cerevisiae
    Gene: TOP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q1db1, d1q1db2
  • Heterogens: MG, CDX, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q1dA (A:)
    ghmvtmstepvsasdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvt
    ivpglfkifdeilvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniy
    ipemifghlltssnydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwen
    nmsichppkitsykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinv
    ylngkslkirnfknyvelylkslekkrqldngedgaaksdiptilyerinnrwevafavs
    disfqqisfvnsiattmggthvnyitdqivkkiseilkkkkkksvksfqiknnmfifinc
    lienpaftsqtkeqlttrvkdfgsrceipleyinkimktdlatrmfeiadaneenalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1dA (A:)
    sasdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvtivpglfkifde
    ilvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniyipemifghllt
    ssnydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwennmsichppkit
    sykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinvylngkslkirn
    fknyvelylksliptilyerinnrwevafavsdisfqqisfvnsiattmggthvnyitdq
    ivkkiseilkkvksfqiknnmfifinclienpaftsqtkeqlttrvkdfgsrceipleyi
    nkimktdlatrmfeiadaneen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q1dB (B:)
    ghmvtmstepvsasdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvt
    ivpglfkifdeilvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniy
    ipemifghlltssnydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwen
    nmsichppkitsykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinv
    ylngkslkirnfknyvelylkslekkrqldngedgaaksdiptilyerinnrwevafavs
    disfqqisfvnsiattmggthvnyitdqivkkiseilkkkkkksvksfqiknnmfifinc
    lienpaftsqtkeqlttrvkdfgsrceipleyinkimktdlatrmfeiadaneenalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1dB (B:)
    asdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvtivpglfkifdei
    lvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniyipemifghllts
    snydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwennmsichppkits
    ykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinvylngkslkirnf
    knyvelylkslekiptilyerinnrwevafavsdisfqqisfvnsiattmggthvnyitd
    qivkkiseilkkvksfqiknnmfifinclienpaftsqtkeqlttrvkdfgsrceipley
    inkimktdlatrmfeiad