PDB entry 1q1c

View 1q1c on RCSB PDB site
Description: Crystal structure of N(1-260) of human FKBP52
Class: isomerase
Keywords: Rotamase, TPR repeat, Nuclear protein, Phosphorylation, ISOMERASE
Deposited on 2003-07-18, released 2004-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FK506-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q1ca1, d1q1ca2
  • Heterogens: DMS, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q1cA (A:)
    mgsshhhhhhssglvprgshmtaeemkatesgaqsaplpmegvdispkqdegvlkvikre
    gtgtempmigdrvfvhytgwlldgtkfdssldrkdkfsfdlgkgevikawdiaiatmkvg
    evchitckpeyaygsagsppkippnatlvfevelfefkgedlteeedggiirriqtrgeg
    yakpnegaivevalegyykdklfdqrelrfeigegenldlpygleraiqrmekgehsivy
    lkpsyafgsvgkekfqippnaelkyelhlksfekakeswe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1cA (A:)
    egvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkdkfsfd
    lgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefkge
    dlteeedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldl
    pygleraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekake