PDB entry 1q1c

View 1q1c on RCSB PDB site
Description: Crystal structure of N(1-260) of human FKBP52
Deposited on 2003-07-18, released 2004-06-22
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q1cA (A:)
    mgsshhhhhhssglvprgshmtaeemkatesgaqsaplpmegvdispkqdegvlkvikre
    gtgtempmigdrvfvhytgwlldgtkfdssldrkdkfsfdlgkgevikawdiaiatmkvg
    evchitckpeyaygsagsppkippnatlvfevelfefkgedlteeedggiirriqtrgeg
    yakpnegaivevalegyykdklfdqrelrfeigegenldlpygleraiqrmekgehsivy
    lkpsyafgsvgkekfqippnaelkyelhlksfekakeswe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1cA (A:)
    egvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkdkfsfd
    lgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefkge
    dlteeedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldl
    pygleraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekake