PDB entry 1q1a

View 1q1a on RCSB PDB site
Description: Structure of the yeast Hst2 protein deacetylase in ternary complex with 2'-O-acetyl ADP ribose and histone peptide
Class: gene regulation
Keywords: ternary complex, histone deacetylase, 2'-O-ADP ribose,
Deposited on 2003-07-18, released 2003-11-18
The last revision prior to the SCOP 1.73 freeze date was dated 2003-11-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.183
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HST2 protein
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1q1aa_
  • Chain 'B':
    Compound: histone h4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02309 (0-9)
      • modified residue (4)
  • Heterogens: ZN, OAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q1aA (A:)
    tastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlarlklpype
    avfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqnidtlerqa
    gvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelvkpaivff
    gedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfaslpeeiprkvkr
    vlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1aA (A:)
    tastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlarlklpype
    avfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqnidtlerqa
    gvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelvkpaivff
    gedlpdsfsetwlndsewlrekittpqqplvivvgtslavypfaslpeeiprkvkrvlcn
    letvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta
    

  • Chain 'B':
    No sequence available.