PDB entry 1q17

View 1q17 on RCSB PDB site
Description: Structure of the yeast Hst2 protein deacetylase in ternary complex with 2'-O-acetyl ADP ribose and histone peptide
Class: Hydrolase
Keywords: histone deacetylase
Deposited on 2003-07-18, released 2003-11-18
The last revision prior to the SCOP 1.73 freeze date was dated 2003-11-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.186
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HST2 protein
    Species: Saccharomyces cerevisiae
    Gene: HST2 OR YPL015C OR LPA2C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53686 (6-299)
      • his tag (2-5)
    Domains in SCOP 1.73: d1q17a_
  • Chain 'B':
    Compound: HST2 protein
    Species: Saccharomyces cerevisiae
    Gene: HST2 OR YPL015C OR LPA2C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53686 (6-299)
      • his tag (0-5)
    Domains in SCOP 1.73: d1q17b_
  • Chain 'C':
    Compound: HST2 protein
    Species: Saccharomyces cerevisiae
    Gene: HST2 OR YPL015C OR LPA2C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53686 (6-299)
      • his tag (1-5)
    Domains in SCOP 1.73: d1q17c_
  • Heterogens: ZN, CL, APR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q17A (A:)
    hhgmasmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhn
    larlklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvyt
    qnidtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcg
    elvkpaivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfasl
    peeiprkvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekiltaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q17A (A:)
    gmasmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnla
    rlklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqn
    idtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgel
    vkpaivffgedlpdsfsetwlndsewlrekiqplvivvgtslavypfaslpeeiprkvkr
    vlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekiltaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q17B (B:)
    hhgmasmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhn
    larlklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvyt
    qnidtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcg
    elvkpaivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfasl
    peeiprkvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekiltaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q17B (B:)
    hhgmasmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhn
    larlklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvyt
    qnidtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcg
    elvkpaivffgedlpdsfsetwlndsewlrekipqqplvivvgtslavypfaslpeeipr
    kvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekiltaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q17C (C:)
    hhgmasmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhn
    larlklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvyt
    qnidtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcg
    elvkpaivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfasl
    peeiprkvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekiltaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q17C (C:)
    hgmasmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnl
    arlklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytq
    nidtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcge
    lvkpaivffgedlpdsfsetwlndsewlrekikhpqqplvivvgtslavypfaslpeeip
    rkvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekiltaq