PDB entry 1q16

View 1q16 on RCSB PDB site
Description: Crystal structure of Nitrate Reductase A, NarGHI, from Escherichia coli
Class: oxidoreductase
Keywords: membrane protein, electron-transfer, OXIDOREDUCTASE
Deposited on 2003-07-18, released 2003-10-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Respiratory nitrate reductase 1 alpha chain
    Species: Escherichia coli [TaxId:562]
    Gene: narG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1q16a1, d1q16a2
  • Chain 'B':
    Compound: Respiratory nitrate reductase 1 beta chain
    Species: Escherichia coli [TaxId:562]
    Gene: narH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1q16b_
  • Chain 'C':
    Compound: Respiratory nitrate reductase 1 gamma chain
    Species: Escherichia coli [TaxId:562]
    Gene: narI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11350 (0-224)
      • modified residue (0)
    Domains in SCOPe 2.04: d1q16c_
  • Heterogens: MD1, 6MO, HEM, SF4, F3S, AGA, 3PH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q16A (A:)
    mskfldrfryfkqkgetfadghgqllntnrdwedgyrqrwqhdkivrsthgvnctgscsw
    kiyvknglvtwetqqtdyprtrpdlpnheprgcprgasyswylysanrlkypmmrkrlmk
    mwreakalhsdpveawasiiedadkaksfkqargrggfvrsswqevneliaasnvytikn
    ygpdrvagfspipamsmvsyasgarylsliggtclsfydwycdlppaspqtwgeqtdvpe
    sadwynssyiiawgsnvpqtrtpdahfftevrykgtktvavtpdyaeiaklcdlwlapkq
    gtdaamalamghvmlrefhldnpsqyftdyvrrytdmpmlvmleerdgyyaagrmlraad
    lvdalgqennpewktvafntngemvapngsigfrwgekgkwnleqrdgktgeetelqlsl
    lgsqdeiaevgfpyfggdgtehfnkvelenvllhklpvkrlqladgstalvttvydltla
    nyglerglndvncatsyddvkaytpawaeqitgvsrsqiiriarefadnadkthgrsmii
    vgaglnhwyhldmnyrglinmlifcgcvgqsgggwahyvgqeklrpqtgwqplafaldwq
    rparhmnstsyfynhssqwryetvtaeellspmadksrytghlidfnvraermgwlpsap
    qlgtnpltiageaekagmnpvdytvkslkegsirfaaeqpengknhprnlfiwrsnllgs
    sgkghefmlkyllgtehgiqgkdlgqqggvkpeevdwqdnglegkldlvvtldfrlsstc
    lysdiilptatwyekddmntsdmhpfihplsaavdpaweaksdweiykaiakkfsevcvg
    hlgketdivtlpiqhdsaaelaqpldvkdwkkgecdlipgktaphimvverdypatyerf
    tsigplmekignggkgiawntqsemdllrklnytkaegpakgqpmlntaidaaemiltla
    petngqvavkawaalseftgrdhthlalnkedekirfrdiqaqprkiissptwsgledeh
    vsynagytnvhelipwrtlsgrqqlyqdhqwmrdfgesllvyrppidtrsvkevigqksn
    gnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndwievfn
    sngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkpthmig
    gyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqesvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q16A (A:)
    skfldrfryfkqkgetfadghgqllntnrdwedgyrqrwqhdkivrsthgvnctgscswk
    iyvknglvtwetqqtdyprtrpdlpnheprgcprgasyswylysanrlkypmmrkrlmkm
    wreakalhsdpveawasiiedadkaksfkqargrggfvrsswqevneliaasnvytikny
    gpdrvagfspipamsmvsyasgarylsliggtclsfydwycdlppaspqtwgeqtdvpes
    adwynssyiiawgsnvpqtrtpdahfftevrykgtktvavtpdyaeiaklcdlwlapkqg
    tdaamalamghvmlrefhldnpsqyftdyvrrytdmpmlvmleerdgyyaagrmlraadl
    vdalgqennpewktvafntngemvapngsigfrwgekgkwnleqrdgktgeetelqlsll
    gsqdeiaevgfpyfggdgtehfnkvelenvllhklpvkrlqladgstalvttvydltlan
    yglerglndvncatsyddvkaytpawaeqitgvsrsqiiriarefadnadkthgrsmiiv
    gaglnhwyhldmnyrglinmlifcgcvgqsgggwahyvgqeklrpqtgwqplafaldwqr
    parhmnstsyfynhssqwryetvtaeellspmadksrytghlidfnvraermgwlpsapq
    lgtnpltiageaekagmnpvdytvkslkegsirfaaeqpengknhprnlfiwrsnllgss
    gkghefmlkyllgtehgiqgkdlgqqggvkpeevdwqdnglegkldlvvtldfrlsstcl
    ysdiilptatwyekddmntsdmhpfihplsaavdpaweaksdweiykaiakkfsevcvgh
    lgketdivtlpiqhdsaaelaqpldvkdwkkgecdlipgktaphimvverdypatyerft
    sigplmekignggkgiawntqsemdllrklnytkaegpakgqpmlntaidaaemiltlap
    etngqvavkawaalseftgrdhthlalnkedekirfrdiqaqprkiissptwsgledehv
    synagytnvhelipwrtlsgrqqlyqdhqwmrdfgesllvyrppidtrsvkevigqksng
    nqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndwievfns
    ngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkpthmigg
    yahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q16B (B:)
    mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
    kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
    qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
    prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
    sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
    ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
    piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
    vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
    gdgchgsdtkfnlfnsrridaidvtsktephp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q16B (B:)
    mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
    kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
    qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
    prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
    sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
    ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
    piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
    vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
    gdgchgsdtkfnlfnsrridaidvtskte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q16C (C:)
    mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
    gifvghffgmltphwmyeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra
    tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
    afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q16C (C:)
    mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
    gifvghffgmltphwmeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvrat
    ttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgva
    fifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh