PDB entry 1q15

View 1q15 on RCSB PDB site
Description: Carbapenam Synthetase
Deposited on 2003-07-18, released 2003-11-04
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q15A (A:)
    msnsfcvvykgsdtdinniqrdfdgkgealsngylfieqnghyqkcemergtayligsly
    nrtfliglagvwegeaylandaellallftrlganalalaegdfcffidepngeltvite
    srgfspvhvvqgkkawmtnslklvtaaegegalwfeeealvcqslmradtytpvknaqrl
    kpgavhvlthdsegysfvesrtlttpasnqllalprepllalidrylnapledlaprfdt
    vgiplsggldsslvtalasrhfkklntysigtelsnefefsqqvadalgthhqmkilset
    evingiiesiyyneifdglsaeiqsglfnvyrqaqgqvscmltgygsdllfggilkpgaq
    ydnpnqllaeqvyrtrwtgefathgascygidirhpfwshslislchalhpdykifdnev
    knilreyadslqllpkdivwrkkigihegssvnqafanvlgstvdnyqtksrftyrvyqa
    flrgrlsitdvtpsqlkdlikkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q15A (A:)
    snsfcvvykgsdtdinniqrdfdgkgealsngylfieqnghyqkcemergtayligslyn
    rtfliglagvwegeaylandaellallftrlganalalaegdfcffidepngeltvites
    rgfspvhvvqgkkawmtnslklvtaaegegalwfeeealvcqslmradtytpvknaqrlk
    pgavhvlthdsegysfvesrtlttpasnqllalprepllalidrylnapledlaprfdtv
    giplsggldsslvtalasrhfkklntysigtelsnefefsqqvadalgthhqmkilsete
    vingiiesiyyneifdglsaeiqsglfnvyrqaqgqvscmltgygsdllfggilkpgaqy
    dnpnqllaeqvyrtrwtgefathgascygidirhpfwshslislchalhpdykifdnevk
    nilreyadslqllpkdivwrsvnqafanvlgstvdnyqtksrftyrvyqaflrgrlsitd
    vtpsqlkdlik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q15B (B:)
    msnsfcvvykgsdtdinniqrdfdgkgealsngylfieqnghyqkcemergtayligsly
    nrtfliglagvwegeaylandaellallftrlganalalaegdfcffidepngeltvite
    srgfspvhvvqgkkawmtnslklvtaaegegalwfeeealvcqslmradtytpvknaqrl
    kpgavhvlthdsegysfvesrtlttpasnqllalprepllalidrylnapledlaprfdt
    vgiplsggldsslvtalasrhfkklntysigtelsnefefsqqvadalgthhqmkilset
    evingiiesiyyneifdglsaeiqsglfnvyrqaqgqvscmltgygsdllfggilkpgaq
    ydnpnqllaeqvyrtrwtgefathgascygidirhpfwshslislchalhpdykifdnev
    knilreyadslqllpkdivwrkkigihegssvnqafanvlgstvdnyqtksrftyrvyqa
    flrgrlsitdvtpsqlkdlikkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q15B (B:)
    snsfcvvykgsdtdinniqrdfdgkgealsngylfieqnghyqkcemergtayligslyn
    rtfliglagvwegeaylandaellallftrlganalalaegdfcffidepngeltvites
    rgfspvhvvqgkkawmtnslklvtaaegegalwfeeealvcqslmradtytpvknaqrlk
    pgavhvlthdsegysfvesrtlttpasnqllalprepllalidrylnapledlaprfdtv
    giplsggldsslvtalasrhfkklntysigtelsnefefsqqvadalgthhqmkilsete
    vingiiesiyyneifdglsaeiqsglfnvyrqaqgqvscmltgygsdllfggilkpgaqy
    dnpnqllaeqvyrtrwtgefathgascygidirhpfwshslislchalhpdykifdnevk
    nilreyadslqllpkdivwrsvnqafanvlgstvdnyqtksrftyrvyqaflrgrlsitd
    vtpsqlkdlik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q15C (C:)
    msnsfcvvykgsdtdinniqrdfdgkgealsngylfieqnghyqkcemergtayligsly
    nrtfliglagvwegeaylandaellallftrlganalalaegdfcffidepngeltvite
    srgfspvhvvqgkkawmtnslklvtaaegegalwfeeealvcqslmradtytpvknaqrl
    kpgavhvlthdsegysfvesrtlttpasnqllalprepllalidrylnapledlaprfdt
    vgiplsggldsslvtalasrhfkklntysigtelsnefefsqqvadalgthhqmkilset
    evingiiesiyyneifdglsaeiqsglfnvyrqaqgqvscmltgygsdllfggilkpgaq
    ydnpnqllaeqvyrtrwtgefathgascygidirhpfwshslislchalhpdykifdnev
    knilreyadslqllpkdivwrkkigihegssvnqafanvlgstvdnyqtksrftyrvyqa
    flrgrlsitdvtpsqlkdlikkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q15C (C:)
    snsfcvvykgsdtdinniqrdfdgkgealsngylfieqnghyqkcemergtayligslyn
    rtfliglagvwegeaylandaellallftrlganalalaegdfcffidepngeltvites
    rgfspvhvvqgkkawmtnslklvtaaegegalwfeeealvcqslmradtytpvknaqrlk
    pgavhvlthdsegysfvesrtlttpasnqllalprepllalidrylnapledlaprfdtv
    giplsggldsslvtalasrhfkklntysigtelsnefefsqqvadalgthhqmkilsete
    vingiiesiyyneifdglsaeiqsglfnvyrqaqgqvscmltgygsdllfggilkpgaqy
    dnpnqllaeqvyrtrwtgefathgascygidirhpfwshslislchalhpdykifdnevk
    nilreyadslqllpkdivwrsvnqafanvlgstvdnyqtksrftyrvyqaflrgrlsitd
    vtpsqlkdlik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q15D (D:)
    msnsfcvvykgsdtdinniqrdfdgkgealsngylfieqnghyqkcemergtayligsly
    nrtfliglagvwegeaylandaellallftrlganalalaegdfcffidepngeltvite
    srgfspvhvvqgkkawmtnslklvtaaegegalwfeeealvcqslmradtytpvknaqrl
    kpgavhvlthdsegysfvesrtlttpasnqllalprepllalidrylnapledlaprfdt
    vgiplsggldsslvtalasrhfkklntysigtelsnefefsqqvadalgthhqmkilset
    evingiiesiyyneifdglsaeiqsglfnvyrqaqgqvscmltgygsdllfggilkpgaq
    ydnpnqllaeqvyrtrwtgefathgascygidirhpfwshslislchalhpdykifdnev
    knilreyadslqllpkdivwrkkigihegssvnqafanvlgstvdnyqtksrftyrvyqa
    flrgrlsitdvtpsqlkdlikkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q15D (D:)
    snsfcvvykgsdtdinniqrdfdgkgealsngylfieqnghyqkcemergtayligslyn
    rtfliglagvwegeaylandaellallftrlganalalaegdfcffidepngeltvites
    rgfspvhvvqgkkawmtnslklvtaaegegalwfeeealvcqslmradtytpvknaqrlk
    pgavhvlthdsegysfvesrtlttpasnqllalprepllalidrylnapledlaprfdtv
    giplsggldsslvtalasrhfkklntysigtelsnefefsqqvadalgthhqmkilsete
    vingiiesiyyneifdglsaeiqsglfnvyrqaqgqvscmltgygsdllfggilkpgaqy
    dnpnqllaeqvyrtrwtgefathgascygidirhpfwshslislchalhpdykifdnevk
    nilreyadslqllpkdivwrqtksrftyrvyqaflrgrlsitdvtpsqlkdli