PDB entry 1q14

View 1q14 on RCSB PDB site
Description: Structure and autoregulation of the yeast Hst2 homolog of Sir2
Class: hydrolase
Keywords: histone deacetylase
Deposited on 2003-07-18, released 2003-09-30
The last revision prior to the SCOP 1.73 freeze date was dated 2003-09-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HST2 protein
    Species: Saccharomyces cerevisiae
    Gene: PROD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53686 (4-End)
      • cloning artifact (0-3)
    Domains in SCOP 1.73: d1q14a_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q14A (A:)
    gmasmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnla
    rlklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqn
    idtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgel
    vkpaivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfaslpe
    eiprkvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekiltaqgg
    mgdnskeqlleivhdlenlsldqsehesadkkdkklqrlnghdsdedgasnssssqkaak
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q14A (A:)
    gmasmsvstastemsvrkiaahmksnpnakvifmvgagistscglarlklpypeavfdvd
    ffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqnidtlerqagvkddl
    iieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelvkpaivffgedlpd
    sfsetwlndsewlrekqqplvivvgtslavypfaslpeeiprkvkrvlcnletvgdfkan
    krptdlivhqysdefaeqlveelgwqedfekiltaqkeqlleivhdlen