PDB entry 1q0z

View 1q0z on RCSB PDB site
Description: Crystal structure of aclacinomycin methylesterase (RdmC) with bound product analogue, 10-decarboxymethylaclacinomycin A (DcmA)
Class: hydrolase
Keywords: Anthracycline, methylesterase, hydrolase, polyketide, Streptomyces, tailoring enzyme, Structural Proteomics in Europe, SPINE, Structural Genomics
Deposited on 2003-07-18, released 2003-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.159
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aclacinomycin methylesterase
    Species: Streptomyces purpurascens [TaxId:1924]
    Gene: rdmc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q0za_
  • Heterogens: AKA, SO4, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q0zA (A:)
    mserivpsgdvelwsddfgdpadpalllvmggnlsalgwpdefarrladgglhvirydhr
    dtgrsttrdfaahpygfgelaadavavldgwgvdrahvvglsmgatitqvialdhhdrls
    sltmllgggldidfdaniervmrgeptldglpgpqqpfldalalmnqpaegraaevakrv
    skwrilsgtgvpfddaeyarweeraidhaggvlaepyahysltlpppsraaelrevtvpt
    lviqaehdpiapaphgkhlagliptarlaeipgmghalpssvhgplaevilahtrsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0zA (A:)
    serivpsgdvelwsddfgdpadpalllvmggnlsalgwpdefarrladgglhvirydhrd
    tgrsttrdfaahpygfgelaadavavldgwgvdrahvvglsmgatitqvialdhhdrlss
    ltmllgggldidfdaniervmrgeptldglpgpqqpfldalalmnqpaegraaevakrvs
    kwrilsgtgvpfddaeyarweeraidhaggvlaepyahysltlpppsraaelrevtvptl
    viqaehdpiapaphgkhlagliptarlaeipgmghalpssvhgplaevilahtrsaa