PDB entry 1q0y

View 1q0y on RCSB PDB site
Description: Anti-Morphine Antibody 9B1 Complexed with Morphine
Class: immune system
Keywords: anti-morphine antibody, fab, immune system
Deposited on 2003-07-17, released 2004-04-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 9B1, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1q0yh1, d1q0yh2
  • Chain 'L':
    Compound: Fab 9B1, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1q0yl1, d1q0yl2
  • Heterogens: MOI, SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1q0yH (H:)
    evqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgdtif
    nekfkgkatftadtssntaymqlssltsedsavyycarwvldyygmdywgqgtsltvssa
    sttppsvyplapggxxxxxxsamvtlgclvkgyfpepvtvvwnkgslstgthtfpavlaa
    dlytlsssvtvsasswpgqsvtcnvahpasstkvdkkiaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0yH (H:)
    evqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgdtif
    nekfkgkatftadtssntaymqlssltsedsavyycarwvldyygmdywgqgtsltvssa
    sttppsvyplapggsamvtlgclvkgyfpepvtvvwnkgslstgthtfpavlaadlytls
    ssvtvsasswpgqsvtcnvahpasstkvdkkiaps
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0yL (L:)
    davvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwsnnklvfgggtkltvlgqpkssptvtl
    fppsseelstakatlvctitdfypgvvtvdwkvdgtpvtagmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghssnktlsra