PDB entry 1q0x

View 1q0x on RCSB PDB site
Description: Anti-morphine Antibody 9B1 Unliganded Form
Class: immune system
Keywords: anti-morphine antibody, fab fragment, immune system
Deposited on 2003-07-17, released 2004-04-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.216
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 9B1, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q0X (0-220)
    Domains in SCOPe 2.03: d1q0xh1, d1q0xh2
  • Chain 'L':
    Compound: Fab 9B1, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1q0xl1, d1q0xl2
  • Heterogens: SO4, PG4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1q0xH (H:)
    evqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgdtif
    nekfkgkatftadtssntaymqlssltsedsavyycarwvldyygmdywgqgtsltvssa
    sttppsvyplapgghhhhhhsamvtlgclvkgyfpepvtvvwnkgslstgthtfpavlaa
    dlytlsssvtvsasswpgqsvtcnvahpasstkvdkkiaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0xH (H:)
    evqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgdtif
    nekfkgkatftadtssntaymqlssltsedsavyycarwvldyygmdywgqgtsltvssa
    sttppsvyplapggsamvtlgclvkgyfpepvtvvwnkgslstgthtfpavlaadlytls
    ssvtvsasswpgqsvtcnvahpasstkvdkkiaps
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0xL (L:)
    davvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwsnnklvfgggtkltvlgqpkssptvtl
    fppsseelstakatlvctitdfypgvvtvdwkvdgtpvtagmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghssnktlsra