PDB entry 1q0w

View 1q0w on RCSB PDB site
Description: solution structure of vps27 amino-terminal uim-ubiquitin complex
Deposited on 2003-07-17, released 2003-10-07
The last revision prior to the SCOP 1.69 freeze date was dated 2003-10-07, with a file datestamp of 2003-10-07.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1q0wa_
  • Chain 'B':
    Domains in SCOP 1.69: d1q0wb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1q0wA (A:)
ypedeeelirkaielslkesrnsa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1q0wB (B:)
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg