PDB entry 1q0q

View 1q0q on RCSB PDB site
Description: crystal structure of dxr in complex with the substrate 1-deoxy-d- xylulose-5-phosphate
Deposited on 2003-07-17, released 2004-07-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q0qA (A:)
    hhhhhhsgmkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspr
    yavmddeasakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptla
    airagktillankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyad
    leqngvvsilltgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgley
    iearwlfnasasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvns
    gvkpldfcklsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqir
    ftdiaalnlsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0qA (A:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q0qB (B:)
    hhhhhhsgmkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspr
    yavmddeasakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptla
    airagktillankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyad
    leqngvvsilltgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgley
    iearwlfnasasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvns
    gvkpldfcklsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqir
    ftdiaalnlsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0qB (B:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas