PDB entry 1q0l

View 1q0l on RCSB PDB site
Description: Crystal structure of DXR in complex with fosmidomycin
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2003-07-16, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.21
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Gene: dxr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0la1, d1q0la2, d1q0la3
  • Heterogens: FOM, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q0lA (A:)
    hhhhhhsgmkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspr
    yavmddeasakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptla
    airagktillankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyad
    leqngvvsilltgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgley
    iearwlfnasasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvns
    gvkpldfcklsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqir
    ftdiaalnlsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0lA (A:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas