PDB entry 1q0h

View 1q0h on RCSB PDB site
Description: crystal structure of selenomethionine-labelled dxr in complex with fosmidomycin
Deposited on 2003-07-16, released 2004-07-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q0hA (A:)
    hhhhhhsgmkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspr
    yavmddeasakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptla
    airagktillankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyad
    leqngvvsilltgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgley
    iearwlfnasasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvns
    gvkpldfcklsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqir
    ftdiaalnlsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0hA (A:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas