PDB entry 1q0h

View 1q0h on RCSB PDB site
Description: Crystal structure of selenomethionine-labelled DXR in complex with fosmidomycin
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2003-07-16, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Gene: dxr
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45568 (8-405)
      • modified residue (8)
      • modified residue (49)
      • modified residue (63)
      • modified residue (75)
      • modified residue (95)
      • modified residue (105)
      • modified residue (143)
      • modified residue (208)
      • modified residue (221)
      • modified residue (232-233)
      • modified residue (253)
      • modified residue (266)
      • modified residue (283)
      • modified residue (291)
      • modified residue (329)
      • modified residue (374)
      • modified residue (376)
      • modified residue (401)
    Domains in SCOPe 2.07: d1q0ha1, d1q0ha2, d1q0ha3
  • Heterogens: FOM, NDP, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q0hA (A:)
    hhhhhhsgmkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspr
    yavmddeasakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptla
    airagktillankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyad
    leqngvvsilltgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgley
    iearwlfnasasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvns
    gvkpldfcklsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqir
    ftdiaalnlsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0hA (A:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas