PDB entry 1q0g

View 1q0g on RCSB PDB site
Description: Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the state after full x-ray-induced reduction
Class: oxidoreductase
Keywords: homohexamer of four-helix bundles, oxidoreductase
Deposited on 2003-07-16, released 2004-05-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.184
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q0ga_
  • Chain 'B':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q0gb_
  • Chain 'C':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q0gc_
  • Chain 'D':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q0gd_
  • Chain 'E':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q0ge_
  • Chain 'F':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q0gf_
  • Chain 'G':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q0gg_
  • Chain 'H':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q0gh_
  • Chain 'I':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q0gi_
  • Chain 'J':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q0gj_
  • Chain 'K':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q0gk_
  • Chain 'L':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q0gl_
  • Heterogens: NI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0gA (A:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0gB (B:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0gC (C:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0gD (D:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0gE (E:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0gF (F:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0gG (G:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0gH (H:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0gI (I:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0gJ (J:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0gK (K:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0gL (L:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka