PDB entry 1q0f

View 1q0f on RCSB PDB site
Description: Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the state after partial x-ray-induced reduction
Deposited on 2003-07-16, released 2004-05-18
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-15, with a file datestamp of 2004-06-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.157
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1q0fa_
  • Chain 'B':
    Domains in SCOP 1.69: d1q0fb_
  • Chain 'C':
    Domains in SCOP 1.69: d1q0fc_
  • Chain 'D':
    Domains in SCOP 1.69: d1q0fd_
  • Chain 'E':
    Domains in SCOP 1.69: d1q0fe_
  • Chain 'F':
    Domains in SCOP 1.69: d1q0ff_
  • Chain 'G':
    Domains in SCOP 1.69: d1q0fg_
  • Chain 'H':
    Domains in SCOP 1.69: d1q0fh_
  • Chain 'I':
    Domains in SCOP 1.69: d1q0fi_
  • Chain 'J':
    Domains in SCOP 1.69: d1q0fj_
  • Chain 'K':
    Domains in SCOP 1.69: d1q0fk_
  • Chain 'L':
    Domains in SCOP 1.69: d1q0fl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0fA (A:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0fB (B:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0fC (C:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0fD (D:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0fE (E:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0fF (F:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0fG (G:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0fH (H:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0fI (I:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0fJ (J:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0fK (K:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0fL (L:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka